PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA261G00001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family B3
Protein Properties Length: 539aa    MW: 61349.1 Da    PI: 7.6316
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA261G00001genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.12.8e-1219871698
                 EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3 16 lvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                 + +p +f++++++       + l++ es r W+v+l      + ++lt+GW+eF+  ++Lk gD++ F++++++ f  +v+v +
  AA261G00001 19 VNVPDEFVTKYKK-------VWLRSdESDRNWRVRL------EDFLLTDGWEEFAAVHNLKNGDVLAFRHEQDDFF--HVSVES 87
                 5678889988863.......555554999*******......88*************************9887666..777655 PP

2B360.43.1e-19151245399
                  EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                   v ++ ++l ++rl l k+f+   +g+  + +++ +++e gr+W++ l  +k++g +++++GWk F+ angL egD + Fkl++ +++++++ +++k
  AA261G00001 151 VVRVTRYTLLHDRLDLGKRFTLLLSGE-YKRREINVQNELGRKWNMLLLPNKSRGVFYIRRGWKTFCCANGLGEGDLCKFKLVE-NGETPLLLLCSK 245
                  6678999999**********9766444.35569***************88999999**************************98.666788888886 PP

3B367.71.7e-213364171799
                  E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE-S CS
           B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvfrk 99 
                  ++pk fa+e+g+kk  s ++tl +++gr+W  +l+ ++ s++++++kGW+e++kang+ +gD+++++l+++  + ++++k+++k
  AA261G00001 336 TFPKGFARENGIKK--SGEITLLNKDGRKWAAYLRRSGESEWFYMRKGWREMCKANGVMVGDSFMLELIWDdANVTPMLKFCSK 417
                  68********9995..458***************99999999***************************99999*******987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.9E-12486IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.603489IPR003340B3 DNA binding domain
CDDcd100178.54E-11585No hitNo description
SMARTSM010193.0E-11789IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.0E-131985IPR015300DNA-binding pseudobarrel domain
PfamPF023622.3E-82185IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.0E-18144245IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.65E-20148246IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.3E-23149246IPR003340B3 DNA binding domain
CDDcd100172.18E-17149244No hitNo description
PROSITE profilePS5086313.676149245IPR003340B3 DNA binding domain
PfamPF023623.3E-18150245IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.7E-17326417IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.3E-20329418IPR003340B3 DNA binding domain
PfamPF023624.9E-21336417IPR003340B3 DNA binding domain
CDDcd100173.45E-16336405No hitNo description
SuperFamilySSF1019361.49E-17336420IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.76337417IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MAEFPPFRQT YLTGNTIIVN VPDEFVTKYK KVWLRSDESD RNWRVRLEDF LLTDGWEEFA  60
AVHNLKNGDV LAFRHEQDDF FHVSVESRSD IVDAQNTSCG YADIGENYTV DNGADVNIDV  120
VDAGGGEDEC HEGNISKKKD QNREADSSCF VVRVTRYTLL HDRLDLGKRF TLLLSGEYKR  180
REINVQNELG RKWNMLLLPN KSRGVFYIRR GWKTFCCANG LGEGDLCKFK LVENGETPLL  240
LLCSKESAIS KSSSREDDDE EEECHEVDAA VKILSTGGCK EEKSITGEGL KGTEKKTPSR  300
FVTLEYTSNH HFSGQLVSNQ NFSWVMNDCR AVAVSTFPKG FARENGIKKS GEITLLNKDG  360
RKWAAYLRRS GESEWFYMRK GWREMCKANG VMVGDSFMLE LIWDDANVTP MLKFCSKIQN  420
PESQRKGRTM TRAAETSGQA KVEARGSKRV TREPEQQEGE KIAARRSSTN QRNLRSMQSR  480
SCSASDHMSK VRRSFVDTLR TVKRFRVELE TREQHLEAAL MEIDGLGEKI SGITKRLFG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99501736
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31610.11e-131B3 family protein